DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32448 and SMIM8

DIOPT Version :9

Sequence 1:NP_001189157.1 Gene:CG32448 / 318032 FlyBaseID:FBgn0052448 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001035958.1 Gene:SMIM8 / 57150 HGNCID:21401 Length:97 Species:Homo sapiens


Alignment Length:83 Identity:29/83 - (34%)
Similarity:44/83 - (53%) Gaps:3/83 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EGKQQGPGDGIRSMRSTGVFRLINFELYTKPNKIIMGLGLTAIAGVFGYIAYMRYKYES-LGYYV 66
            |.:.|.|  |:|.:|:|.:||.:|.||:.||||.:|..||..::....||.|:....|: ...|.
Human    17 EKEFQSP--GLRGVRTTTLFRAVNPELFIKPNKPVMAFGLVTLSLCVAYIGYLHAIQENKKDLYE 79

  Fly    67 AVQENGQEKFIKKKSNWE 84
            |:...|.....:|.|.|:
Human    80 AIDSEGHSYMRRKTSKWD 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32448NP_001189157.1 DUF4500 5..83 CDD:405605 27/78 (35%)
SMIM8NP_001035958.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 3/8 (38%)
DUF4500 15..96 CDD:317361 28/80 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11503
eggNOG 1 0.900 - - E1_2BYUN
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5452
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46129
OrthoDB 1 1.010 - - D1574927at2759
OrthoFinder 1 1.000 - - FOG0008176
OrthoInspector 1 1.000 - - oto91184
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14274
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5189
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.970

Return to query results.
Submit another query.