DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32448 and smim8

DIOPT Version :9

Sequence 1:NP_001189157.1 Gene:CG32448 / 318032 FlyBaseID:FBgn0052448 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001019604.2 Gene:smim8 / 554139 ZFINID:ZDB-GENE-050522-423 Length:104 Species:Danio rerio


Alignment Length:91 Identity:30/91 - (32%)
Similarity:49/91 - (53%) Gaps:10/91 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GKQQGPGD---------GIRSMRSTGVFRLINFELYTKPNKIIMGLGLTAIAGVFGYIAYMRYKY 59
            |.|:.|..         |:|.:|:|.:||.:|.||:.:|||.:|.|||.|::...||:.|:....
Zfish    14 GPQEPPSSAAEPAYRSPGLRGVRTTSLFRAVNPELFIRPNKPVMALGLLALSVCVGYLGYLHAIR 78

  Fly    60 ES-LGYYVAVQENGQEKFIKKKSNWE 84
            :| ...|.||..:|:....::.|.|:
Zfish    79 DSDQQLYEAVDSDGETYMRRRTSRWD 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32448NP_001189157.1 DUF4500 5..83 CDD:405605 28/87 (32%)
smim8NP_001019604.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 3/16 (19%)
DUF4500 24..103 CDD:291598 26/78 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574872
Domainoid 1 1.000 56 1.000 Domainoid score I11040
eggNOG 1 0.900 - - E1_2BYUN
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I5434
OMA 1 1.010 - - QHG46129
OrthoDB 1 1.010 - - D1574927at2759
OrthoFinder 1 1.000 - - FOG0008176
OrthoInspector 1 1.000 - - oto41347
orthoMCL 1 0.900 - - OOG6_109438
Panther 1 1.100 - - LDO PTHR14274
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5189
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.