DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32448 and smim8

DIOPT Version :9

Sequence 1:NP_001189157.1 Gene:CG32448 / 318032 FlyBaseID:FBgn0052448 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001016334.1 Gene:smim8 / 549088 XenbaseID:XB-GENE-940262 Length:97 Species:Xenopus tropicalis


Alignment Length:84 Identity:29/84 - (34%)
Similarity:44/84 - (52%) Gaps:1/84 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SEGKQQGPGDGIRSMRSTGVFRLINFELYTKPNKIIMGLGLTAIAGVFGYIAYMRYKYES-LGYY 65
            |..|::....|:|.:::|.:||.:|.||:.||||.:|..|:..|.....||||:....|: ...|
 Frog    14 SPPKEEYRTPGLRGVKTTTLFRAVNPELFIKPNKPVMVFGIVTITMCVAYIAYLHATEENKRELY 78

  Fly    66 VAVQENGQEKFIKKKSNWE 84
            .||...|.....:|.|.|:
 Frog    79 EAVDSEGNRYTRRKSSKWD 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32448NP_001189157.1 DUF4500 5..83 CDD:405605 27/78 (35%)
smim8NP_001016334.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 3/11 (27%)
DUF4500 15..96 CDD:405605 27/80 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11311
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I5257
OMA 1 1.010 - - QHG46129
OrthoDB 1 1.010 - - D1574927at2759
OrthoFinder 1 1.000 - - FOG0008176
OrthoInspector 1 1.000 - - oto104967
Panther 1 1.100 - - LDO PTHR14274
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5189
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.110

Return to query results.
Submit another query.