DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32448 and Smim8

DIOPT Version :9

Sequence 1:NP_001189157.1 Gene:CG32448 / 318032 FlyBaseID:FBgn0052448 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001188303.1 Gene:Smim8 / 297971 RGDID:1305158 Length:97 Species:Rattus norvegicus


Alignment Length:74 Identity:26/74 - (35%)
Similarity:38/74 - (51%) Gaps:1/74 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GIRSMRSTGVFRLINFELYTKPNKIIMGLGLTAIAGVFGYIAYMRYKYES-LGYYVAVQENGQEK 75
            |:|....|.:||.:|.||:.||||.:|..||.|::....||.|:....|: ...|.|:...|...
  Rat    24 GLRGTHPTTLFRAVNPELFIKPNKPVMAFGLVALSLCVAYIGYLHATQENKKDLYEAIDSEGHRY 88

  Fly    76 FIKKKSNWE 84
            ..:|.|.|:
  Rat    89 MRRKTSKWD 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32448NP_001189157.1 DUF4500 5..83 CDD:405605 25/71 (35%)
Smim8NP_001188303.1 DUF4500 16..96 CDD:405605 25/71 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335676
Domainoid 1 1.000 51 1.000 Domainoid score I11321
eggNOG 1 0.900 - - E1_2BYUN
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5364
OMA 1 1.010 - - QHG46129
OrthoDB 1 1.010 - - D1574927at2759
OrthoFinder 1 1.000 - - FOG0008176
OrthoInspector 1 1.000 - - oto98270
orthoMCL 1 0.900 - - OOG6_109438
Panther 1 1.100 - - LDO PTHR14274
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.