DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arv1 and ARV1

DIOPT Version :9

Sequence 1:NP_730651.1 Gene:Arv1 / 318031 FlyBaseID:FBgn0052442 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001318899.1 Gene:ARV1 / 839569 AraportID:AT1G01020 Length:245 Species:Arabidopsis thaliana


Alignment Length:179 Identity:50/179 - (27%)
Similarity:79/179 - (44%) Gaps:31/179 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CVNCGHRVKELFKKYS-NTMKTTQCDNCHQITDKYIEFEEFIILIDALLLDSCAFRHIIYN---- 68
            ||.||.|||.||.:|| ..::..:|.||.::.|:|||.|..||.||.:|.....:||::||    
plant     8 CVGCGFRVKSLFIQYSPGNIRLMKCGNCKEVADEYIECERMIIFIDLILHRPKVYRHVLYNAINP 72

  Fly    69 ---GDFKLYWKVSLVVLLLESFALCRQKLPDPPNASLHVHEKGFYTYTLQNMGDYMFMTLLLLII 130
               ....|.||:....|||:.:.....:..|        .|..|       ....:.:::.:||.
plant    73 ATVNIQHLLWKLVFAYLLLDCYRSLLLRKSD--------EESSF-------SDSPVLLSIKVLIG 122

  Fly   131 TATLSIDWMQKIGFRNFSLI--------ILKVVLISNLSKFFLLPILVW 171
            ..:.:..::.........|:        |:..:.||:..|.|||.:|||
plant   123 VLSANAAFIISFAIATKGLLNEVSRRREIMLGIFISSYFKIFLLAMLVW 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arv1NP_730651.1 Arv1 8..194 CDD:282071 50/179 (28%)
ARV1NP_001318899.1 Arv1 7..192 CDD:367849 50/179 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2961
eggNOG 1 0.900 - - E1_COG5254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I2368
OMA 1 1.010 - - QHG54936
OrthoDB 1 1.010 - - D1466379at2759
OrthoFinder 1 1.000 - - FOG0004029
OrthoInspector 1 1.000 - - otm2737
orthoMCL 1 0.900 - - OOG6_104234
Panther 1 1.100 - - LDO PTHR14467
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3879
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.