DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arv1 and ARV2

DIOPT Version :9

Sequence 1:NP_730651.1 Gene:Arv1 / 318031 FlyBaseID:FBgn0052442 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001328720.1 Gene:ARV2 / 826763 AraportID:AT4G01510 Length:260 Species:Arabidopsis thaliana


Alignment Length:217 Identity:57/217 - (26%)
Similarity:94/217 - (43%) Gaps:66/217 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EKKRFVCVNCGHRVKELFKKYS-NTMKTTQCDNCHQITDKYIE---------------------- 44
            |||  .||.|||:||.||.:|| ...:..:|:||.::.|:|:|                      
plant     4 EKK--TCVECGHKVKSLFIQYSPGNFRLMKCENCEEVADEYVECELLVYIYMSLYFQVSIFMLLC 66

  Fly    45 ---FEEF-------IILIDALLLDSCAFRHIIYN-------GDFKLYWKVSLVVLLLESF-ALCR 91
               |:.|       ||.||.:|..:.|:||::||       ....|.||:.|..|||::: :|..
plant    67 SSSFDFFVCFDNHQIIFIDLILHKTKAYRHLLYNVVNQESANVQHLLWKLVLAYLLLDTYRSLLL 131

  Fly    92 QKLPDPPNASLHVHEKGFYTYTLQNMGDYMFMTLLLLIITATLSIDWMQKIGFRNFSLI------ 150
            ::..|..|.|:                .::|.:|.:|:...:.:..::....|....::      
plant   132 RRTNDGSNVSM----------------SFLFESLEVLVNVLSANFAFVFSFAFAAKLMLVMPRGK 180

  Fly   151 -ILKVVLISNLSKFFLLPILVW 171
             ||..:|||:..|.||..:.||
plant   181 EILLTILISSYVKIFLFAMPVW 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arv1NP_730651.1 Arv1 8..194 CDD:282071 54/212 (25%)
ARV2NP_001328720.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2961
eggNOG 1 0.900 - - E1_COG5254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I2368
OMA 1 1.010 - - QHG54936
OrthoDB 1 1.010 - - D1466379at2759
OrthoFinder 1 1.000 - - FOG0004029
OrthoInspector 1 1.000 - - otm2737
orthoMCL 1 0.900 - - OOG6_104234
Panther 1 1.100 - - O PTHR14467
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3879
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.