DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arv1 and Arv1

DIOPT Version :9

Sequence 1:NP_730651.1 Gene:Arv1 / 318031 FlyBaseID:FBgn0052442 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001355301.1 Gene:Arv1 / 68865 MGIID:1916115 Length:266 Species:Mus musculus


Alignment Length:237 Identity:62/237 - (26%)
Similarity:113/237 - (47%) Gaps:38/237 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CVNCGHRVKELFKKYSN-TMKTTQCDNCHQITDKYIEFEEFIILIDALLLDSCAFRHIIYNGDFK 72
            |:.|....:||::.||: .:|.|.|.:|.:..|||||::..||||:|:|..:.|:|||::|....
Mouse    29 CIECNREAQELYRDYSHGVLKITICKSCQKPVDKYIEYDPVIILINAILCKTQAYRHILFNTKIN 93

  Fly    73 LYWKVSLVVLLLESFALCRQ-----KLPDPPNASLHVHEKGFY-TYTLQNMGDYMFMTLLLLII- 130
            ::.|:.:..||.|::....|     :.|.|.:...:..|..|| .:.:.:.....|:|.:...: 
Mouse    94 IHGKLCMFCLLCEAYLRWWQLQDSSQSPAPDDVIRYAKEWDFYRMFVIASFEQAAFLTGIFAFLW 158

  Fly   131 -----TATLSIDWMQKIGFRNFSLIILKVVLISNLSKFFLLPILVWRNNTTVFGRNLHHLLVMGH 190
                 ||..:.|:          :::||.:|:|:..|..|:|.::|.::.|.....|..:.|   
Mouse   159 VQQPMTAKRAPDF----------VLLLKALLLSSYGKLLLIPAVIWEHDYTPLCLRLIKVFV--- 210

  Fly   191 HLCSLVLAYQAVGATRKNLRWWALTLV--------VIAFAFK 224
                |...:|||..|....|..:|.:|        ::.|.|:
Mouse   211 ----LTSNFQAVRVTLNTNRRLSLLVVLSGLLLESIVVFFFQ 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arv1NP_730651.1 Arv1 8..194 CDD:282071 52/197 (26%)
Arv1NP_001355301.1 Arv1 28..217 CDD:367849 53/200 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837201
Domainoid 1 1.000 85 1.000 Domainoid score I8208
eggNOG 1 0.900 - - E1_COG5254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5153
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54936
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004029
OrthoInspector 1 1.000 - - oto91993
orthoMCL 1 0.900 - - OOG6_104234
Panther 1 1.100 - - LDO PTHR14467
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R92
SonicParanoid 1 1.000 - - X3879
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.