DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arv1 and ARV1

DIOPT Version :9

Sequence 1:NP_730651.1 Gene:Arv1 / 318031 FlyBaseID:FBgn0052442 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_024304970.1 Gene:ARV1 / 64801 HGNCID:29561 Length:312 Species:Homo sapiens


Alignment Length:272 Identity:66/272 - (24%)
Similarity:111/272 - (40%) Gaps:89/272 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RFVCVNCGHRVKELFKKYSN-TMKTTQCDNCHQITDKYIEFEEFIILIDALLLDSCAFRHIIYNG 69
            ::.|:.|....|||::.|:: .:|.|.|.:|.:..|||||::..||||:|:|..:.|:|||::|.
Human    31 QYRCIECNQEAKELYRDYNHGVLKITICKSCQKPVDKYIEYDPVIILINAILCKAQAYRHILFNT 95

  Fly    70 DFKLYWKVSLVVLLLESFALCRQKLPD------PPNASLHVHEKGFYTYTLQNMGDYMF------ 122
            ...::.|:.:..||.|:: |...:|.|      |.:...:..|..||.         ||      
Human    96 QINIHGKLCIFCLLCEAY-LRWWQLQDSNQNTAPDDLIRYAKEWDFYR---------MFAIAALD 150

  Fly   123 -MTLLLL--------IITATLSIDWMQK-------------------IGFRNF------------ 147
             ::|..|        .:||.|: .|.|.                   ||...|            
Human   151 RVSLCCLGWSAVAQSQLTAALN-SWAQAILLPRPPQVAGTTEQTAYFIGIFTFLWVERPMTAKKK 214

  Fly   148 --SLIILKVVLISNLSKFFLLPILVWRNNTT--------VF---------------GRNLHHLLV 187
              .:::||.:|:|:..|..|:|.::|.::.|        ||               .|.|..|.|
Human   215 PNFILLLKALLLSSYGKLLLIPAVIWEHDYTSVCLKLIKVFVLTSNFQAIRVTLNINRKLSFLAV 279

  Fly   188 MGHHLCSLVLAY 199
            :...|...::.|
Human   280 LSGLLLESIMVY 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arv1NP_730651.1 Arv1 8..194 CDD:282071 65/263 (25%)
ARV1XP_024304970.1 Arv1 33..263 CDD:309333 60/240 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147269
Domainoid 1 1.000 81 1.000 Domainoid score I8595
eggNOG 1 0.900 - - E1_COG5254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I5229
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54936
OrthoDB 1 1.010 - - D1466379at2759
OrthoFinder 1 1.000 - - FOG0004029
OrthoInspector 1 1.000 - - oto88422
orthoMCL 1 0.900 - - OOG6_104234
Panther 1 1.100 - - LDO PTHR14467
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R92
SonicParanoid 1 1.000 - - X3879
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.