DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arv1 and arv1

DIOPT Version :9

Sequence 1:NP_730651.1 Gene:Arv1 / 318031 FlyBaseID:FBgn0052442 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001107083.1 Gene:arv1 / 568203 ZFINID:ZDB-GENE-080204-35 Length:239 Species:Danio rerio


Alignment Length:214 Identity:67/214 - (31%)
Similarity:107/214 - (50%) Gaps:26/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FVCVNCGHRVKELFKKYSN-TMKTTQCDNCHQITDKYIEFEEFIILIDALLLDSCAFRHIIYNGD 70
            |.||.|.....||.:.||| .:|.|.|.:|.:..|||||::..||||||.|....|||||::|.:
Zfish     6 FKCVECNEDANELHRDYSNGILKITICSSCRKPVDKYIEYDPVIILIDATLCKIQAFRHILFNTE 70

  Fly    71 FKLYWKVSLVVLLLESF---ALCR--QKLPDPPNASLHVHEKGFY-TYTLQNMGDYMFMTLLLLI 129
            ..::||:.:..||.|::   :|.:  |...||.:...:..|..|| .:.|..:...:|...:|:|
Zfish    71 INIHWKLCVFCLLCEAYLRWSLLQGSQSSSDPADIIRYTKEWEFYCMFALAALELTVFFIGVLVI 135

  Fly   130 ITATLSIDWMQKIGFRNFSL---IILKVVLISNLSKFFLLPILVWRNNTTVFGRNLHHLLVMGHH 191
            :       |..:. |...||   .:||.:|:|:..|..|:|.::|.::.:....:|..|.|:..:
Zfish   136 L-------WTAQC-FSGASLQFAPLLKALLLSSYGKVLLIPAVIWEHDFSPLCFSLIRLFVLTSN 192

  Fly   192 L--------CSLVLAYQAV 202
            .        ||..|:..||
Zfish   193 SQAIRVILNCSRRLSLLAV 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arv1NP_730651.1 Arv1 8..194 CDD:282071 61/203 (30%)
arv1NP_001107083.1 Arv1 8..195 CDD:282071 61/194 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580790
Domainoid 1 1.000 90 1.000 Domainoid score I7772
eggNOG 1 0.900 - - E1_COG5254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5081
OMA 1 1.010 - - QHG54936
OrthoDB 1 1.010 - - D1466379at2759
OrthoFinder 1 1.000 - - FOG0004029
OrthoInspector 1 1.000 - - oto40436
orthoMCL 1 0.900 - - OOG6_104234
Panther 1 1.100 - - LDO PTHR14467
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R92
SonicParanoid 1 1.000 - - X3879
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.