DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arv1 and arv1

DIOPT Version :9

Sequence 1:NP_730651.1 Gene:Arv1 / 318031 FlyBaseID:FBgn0052442 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001016452.1 Gene:arv1 / 549206 XenbaseID:XB-GENE-943069 Length:232 Species:Xenopus tropicalis


Alignment Length:206 Identity:52/206 - (25%)
Similarity:101/206 - (49%) Gaps:22/206 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CVNCGHRVKELFKKYSN-TMKTTQCDNCHQITDKYIEFEEFIILIDALLLDSCAFRHIIYNGDFK 72
            |:.|....:||::.|.: .:|.|.|.:|.:..|||||::..||||:|:|..:.|:||:::|....
 Frog    11 CIECSKESRELYRDYRHGVLKITICKSCQKPVDKYIEYDPVIILINAMLCKAQAYRHVLFNTSIN 75

  Fly    73 LYWKVSLVVLLLESFALCRQ-----KLPDPPNASLHVHEKGFYT---YTLQNMGDYMFMTLLLLI 129
            ::.|:.:..||.|::....|     .:.:|.:...:..|..||.   .....:..|:....:.|.
 Frog    76 IHGKLCIFCLLCEAYTRWLQLPGSSNITNPEDIIRYAKEWDFYRLFGIAALELTAYLTGVFIALC 140

  Fly   130 ITATLSIDWMQKIGFRNFSLIILKVVLISNLSKFFLLPILVWRNNTTVFGRNLHHLLVMGHHLCS 194
            :....::.     .:.:|:| :||.:|:|:..|..|:|.::|.::.|.....|..|.|:..::  
 Frog   141 LARPKTLQ-----SYADFAL-LLKALLLSSYGKLLLIPAVIWEHDYTNLCLRLITLFVLTSNM-- 197

  Fly   195 LVLAYQAVGAT 205
                 ||:..|
 Frog   198 -----QAIRVT 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arv1NP_730651.1 Arv1 8..194 CDD:282071 49/193 (25%)
arv1NP_001016452.1 Arv1 10..199 CDD:367849 49/200 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8533
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5059
OMA 1 1.010 - - QHG54936
OrthoDB 1 1.010 - - D1466379at2759
OrthoFinder 1 1.000 - - FOG0004029
OrthoInspector 1 1.000 - - oto102302
Panther 1 1.100 - - LDO PTHR14467
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R92
SonicParanoid 1 1.000 - - X3879
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.110

Return to query results.
Submit another query.