DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arv1 and Arv1

DIOPT Version :9

Sequence 1:NP_730651.1 Gene:Arv1 / 318031 FlyBaseID:FBgn0052442 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_008770828.1 Gene:Arv1 / 292097 RGDID:1310264 Length:279 Species:Rattus norvegicus


Alignment Length:108 Identity:35/108 - (32%)
Similarity:61/108 - (56%) Gaps:6/108 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CVNCGHRVKELFKKYSN-TMKTTQCDNCHQITDKYIEFEEFIILIDALLLDSCAFRHIIYNGDFK 72
            |:.|....:||::.|:: .:|.|.|.:|.:..|||||::..||||:|:|..:.|:|||::|....
  Rat    30 CIECNREARELYRDYNHGVLKITICKSCQKPVDKYIEYDPVIILINAILCKTQAYRHILFNTQIN 94

  Fly    73 LYWKVSLVVLLLESFALCRQ-----KLPDPPNASLHVHEKGFY 110
            ::.|:.:..||.|::....|     :.|.|.:...:..|..||
  Rat    95 IHGKLCMFCLLCEAYLRWWQLQDSSQSPAPDDVIRYAKEWDFY 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arv1NP_730651.1 Arv1 8..194 CDD:282071 35/108 (32%)
Arv1XP_008770828.1 Arv1 29..>145 CDD:282071 35/108 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340919
Domainoid 1 1.000 84 1.000 Domainoid score I8127
eggNOG 1 0.900 - - E1_COG5254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I5075
OMA 1 1.010 - - QHG54936
OrthoDB 1 1.010 - - D1466379at2759
OrthoFinder 1 1.000 - - FOG0004029
OrthoInspector 1 1.000 - - oto95562
orthoMCL 1 0.900 - - OOG6_104234
Panther 1 1.100 - - LDO PTHR14467
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3879
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.770

Return to query results.
Submit another query.