DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arv1 and arv1

DIOPT Version :9

Sequence 1:NP_730651.1 Gene:Arv1 / 318031 FlyBaseID:FBgn0052442 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_593529.3 Gene:arv1 / 2543427 PomBaseID:SPAPB1A10.15 Length:266 Species:Schizosaccharomyces pombe


Alignment Length:244 Identity:53/244 - (21%)
Similarity:109/244 - (44%) Gaps:46/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CVNCGHRVKELFKKY---SNTMKTTQCDNCHQITDKYIEFEEFIILIDALLLDSCAFRHIIYNG- 69
            ||.||..|..|:..|   ::.::..||.||.|..|||||.:..:|.:|.:|:....:||:::|. 
pombe     3 CVECGAEVDSLYTYYGRGTSNIRLAQCKNCKQFADKYIELDVVLISMDVILMKPQVYRHLLFNSL 67

  Fly    70 ---DFKLYWKVSLVVLLLESFALCRQKLPDPPNASLHVH---EKGFYTYTLQNMGDYMFMTLLLL 128
               .|:......:::.|...| |...:|  ...|:|..:   .:.|.:..:  :..|:.:.|:.|
pombe    68 SARTFRNVVNFCILISLFNVF-LVWSRL--EKRAALFPYFTPAQAFLSQPI--IRQYLTLLLICL 127

  Fly   129 IITATLSIDWM----QKIGFRNFSLIILKVVLISNLSKFFLLPI--LVWRNNTTVFGRNLHHLLV 187
            :.|....|..:    ..:|:::::.....|:|.|:..   :||:  ::|..:.::....:..:::
pombe   128 VETTVYQISVVLLLCLTMGWKSWTSASGAVILSSSTR---MLPVFMVIWDYDLSIAATVVEWVVL 189

  Fly   188 MGH--HLCSLVLAYQAVGATRKNLRWWALTLVVIAFAFKETARQFVSLV 234
            ..:  .||.|.          .:.|::.:.|:|:          |.|||
pombe   190 FSNVDALCILT----------GSRRYFKIGLIVL----------FASLV 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arv1NP_730651.1 Arv1 8..194 CDD:282071 44/202 (22%)
arv1NP_593529.3 Arv1 1..206 CDD:304507 47/220 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004029
OrthoInspector 1 1.000 - - oto100466
orthoMCL 1 0.900 - - OOG6_104234
Panther 1 1.100 - - LDO PTHR14467
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R92
SonicParanoid 1 1.000 - - X3879
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.