DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arv1 and arv-1

DIOPT Version :9

Sequence 1:NP_730651.1 Gene:Arv1 / 318031 FlyBaseID:FBgn0052442 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001369870.1 Gene:arv-1 / 187628 WormBaseID:WBGene00011040 Length:236 Species:Caenorhabditis elegans


Alignment Length:253 Identity:57/253 - (22%)
Similarity:93/253 - (36%) Gaps:97/253 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EKKRFVCVNCGHRVKELFKKYS-NTMKTTQCDNCHQITDKYIEFEEFIILIDALLLDSCAFRHII 66
            ||:.|.||||......|:|||| ..::.|:||||.::.|||||::..:::||.:|....|:||::
 Worm    16 EKEEFACVNCQEFTSTLYKKYSEGVIRLTECDNCGEVVDKYIEYDVVLVVIDLMLQYVQAYRHLL 80

  Fly    67 YNGDFKLYWKVSLVVLLLESFALCRQKLPDPPNASLHVHEKGFYTYTLQNMGD------------ 119
            .|                     .|.:.|          |:.|..:.|.:..|            
 Worm    81 LN---------------------VRIQRP----------ERLFVIFWLSHAADVWIRDNKNNEAK 114

  Fly   120 ------YMFMTLLLLIITATLSIDWMQKIGFRNFSLIILKVVLISNLSKFFLLPILVWRNNTTVF 178
                  :||...|||.:....|               .:..:|:.:|          |:|:.|  
 Worm   115 ELTDQEWMFYRCLLLSVVEIFS---------------FISAILMYSL----------WKNDET-- 152

  Fly   179 GRNLHHLLVMGHHLCSLVLAYQAVGATRKNLRWWALTLVVIAFAFKETARQFVSLVVE 236
              |...|      :.|.:|.|            :....|.|:|.|..:.|....:|::
 Worm   153 --NYRQL------IASTLLGY------------YGNVAVFISFVFCLSHRTSYQIVMQ 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arv1NP_730651.1 Arv1 8..194 CDD:282071 45/204 (22%)
arv-1NP_001369870.1 Arv1 22..167 CDD:398023 48/222 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159400
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54936
OrthoDB 1 1.010 - - D1466379at2759
OrthoFinder 1 1.000 - - FOG0004029
OrthoInspector 1 1.000 - - oto18563
orthoMCL 1 0.900 - - OOG6_104234
Panther 1 1.100 - - LDO PTHR14467
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R92
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.840

Return to query results.
Submit another query.