DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42272 and AT2G44230

DIOPT Version :9

Sequence 1:NP_729101.2 Gene:CG42272 / 318020 FlyBaseID:FBgn0259167 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_030961.1 Gene:AT2G44230 / 819031 AraportID:AT2G44230 Length:542 Species:Arabidopsis thaliana


Alignment Length:278 Identity:66/278 - (23%)
Similarity:94/278 - (33%) Gaps:112/278 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 GGTYPDDNLEENSIGQAPEKEEGPGKGKLPGFHVTYWMFYPYSQGKTMCTVSLG--PLGRIPFPA 393
            |||:.|                           :..|||||:: |.:...:...  ||||     
plant   334 GGTFTD---------------------------IAVWMFYPFN-GPSRAKLKAASIPLGR----- 365

  Fly   394 VYGYCLGNRKDIGSHVGDWEHMSLYF-NGDAEPQAMYVSAHDAGAYYSYNRLTGSFEFRRQETRK 457
                       ||.|:|||||.:|.. |...:...||:|.|..|::...:.:         |.:.
plant   366 -----------IGEHIGDWEHFTLRISNFSGKLHRMYLSQHSGGSWADASEI---------EFQG 410

  Fly   458 GILQRPNFPKTVTTFKNHPVLFAAKGSHGLWTAPGKHRFVKVARLYDINGFGTPWNTWKA---VD 519
            |              .|.||.:|:...|.:::.||       ..|...:..|...:|.|:   :|
plant   411 G--------------GNKPVAYASLNGHAMYSKPG-------LVLQGKDNVGIRNDTGKSEKVID 454

  Fly   520 -------ISYENLRSYGRSLVPDWLTYRGKWGNPK-------------------SNCHPFRRI-- 556
                   ::.|.:|  |....|.||.|...|| ||                   |....||..  
plant   455 TAVRFRVVAAEYMR--GELEEPAWLNYMRHWG-PKIDYGHENEIRGVEKIMVGESLKTTFRSAIK 516

  Fly   557 GL-NFCEFTDGPTGIPLK 573
            || |.....:||||..||
plant   517 GLPNEVFGEEGPTGPKLK 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42272NP_729101.2 DUF946 <367..>437 CDD:283705 24/72 (33%)
AT2G44230NP_030961.1 Vps62 17..541 CDD:368746 66/278 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3201
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.