DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42272 and Prpf39

DIOPT Version :9

Sequence 1:NP_729101.2 Gene:CG42272 / 318020 FlyBaseID:FBgn0259167 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001101496.2 Gene:Prpf39 / 314171 RGDID:1308702 Length:664 Species:Rattus norvegicus


Alignment Length:380 Identity:66/380 - (17%)
Similarity:119/380 - (31%) Gaps:147/380 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 QYNQLNEY-----------EELVME----ATQKPSV-QQDSEPEPENGVPVN---NFIANLAD-N 326
            |.:.::||           .|:|:|    :|:..:| :.:..|:....|.|:   |.:||..| .
  Rat     2 QNSHMDEYRNSDNGSTGNSSEVVIEHPDFSTEIMNVTEMEQSPDASPSVRVSTEENEMANAVDLP 66

  Fly   327 VKFSGGTYPDD------NLEENSIGQAPEKEEGPGKGKLPGFHVTYWMF---YPYSQGKTMCTVS 382
            |..:.|.:|.:      .:|.|     |:...|             |::   |...:...|....
  Rat    67 VTETEGNFPPEFEKFWKTVETN-----PQDFTG-------------WVYLLQYVEQENHLMAARK 113

  Fly   383 LGPLGRIPFPAVYGYC-----LGNRKD---------------IGSHVGDWEHMSLYFN------- 420
            ......|.:|..|||.     |..|.|               |...|..|.|   |.|       
  Rat   114 AFDKFFIHYPYCYGYWKKYADLEKRHDNIKQSDEVYRRGLQAIPLSVDLWIH---YINFLKETLD 175

  Fly   421 -GDAEPQA------------------------MYVS-AHDAGAYYS----YNRLTG------SFE 449
             ||.|..:                        ||:: .::.|....    |:|:.|      |..
  Rat   176 PGDPETNSTIRGTFEHAVLAAGTDFRSDKLWEMYINWENEQGNLREVTAVYDRILGIPTQLYSHH 240

  Fly   450 FRRQETRKGILQRPNFPKTVTT----FKNHPVLFAAKGSHGLWTAPG------------------ 492
            |:|.:..    .:.|.|:.:.|    .:....|.:..|.:|....||                  
  Rat   241 FQRFKEH----VQNNLPRDLLTGEQFIQLRRELASVNGHNGDDGPPGDDLPSGIEDITDPAKLIT 301

  Fly   493 -----KHRFVKVAR---LYDINGFGTPWNTWKAVDISYENLRSYGRSLVPDWLTY 539
                 :||.:::.:   .|:.:.....|...:.:...|.:::...::.:.:|..|
  Rat   302 EIENMRHRIIEIHQEMFNYNEHEVSKRWTFEEGIKRPYFHVKPLEKAQLKNWKEY 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42272NP_729101.2 DUF946 <367..>437 CDD:283705 22/125 (18%)
Prpf39NP_001101496.2 RNA14 67..>537 CDD:227438 51/315 (16%)
TPR repeat 452..480 CDD:276809
TPR repeat 485..519 CDD:276809
TPR repeat 524..554 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336880
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.