DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and RLT2

DIOPT Version :10

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_199231.1 Gene:RLT2 / 834441 AraportID:AT5G44180 Length:1694 Species:Arabidopsis thaliana


Alignment Length:117 Identity:33/117 - (28%)
Similarity:57/117 - (48%) Gaps:30/117 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 QGMWGVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAK 121
            :|..|.:..|::.:    |.|||:|||..:....||...:|.::::|:||.:.::|:||.:||.|
plant    11 EGCGGESKSKRKMK----TAAQLEVLENTYSAEPYPSEAIRADLSVKLNLSDRQLQMWFCHRRLK 71

  Fly   122 CRQQL----QQQQQ---------------------SNSLSSSKNASG-GGSG 147
            .|:..    :|:::                     .|.|.|.:.|.| ||||
plant    72 ERKSTTPSKRQRKELVTPTAMESWEPPVNAGDLVAGNELDSRRAARGSGGSG 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeodomain 68..123 CDD:459649 19/54 (35%)
RLT2NP_199231.1 Homeodomain 18..74 CDD:459649 20/59 (34%)
DUF5401 <322..>457 CDD:375164
DDT 515..570 CDD:460696
HARE-HTH 696..765 CDD:461541
WHIM1 899..941 CDD:464774
WSD 1071..1145 CDD:464775
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.