DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and crx

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_694419.1 Gene:crx / 81881 ZFINID:ZDB-GENE-010403-1 Length:281 Species:Danio rerio


Alignment Length:249 Identity:96/249 - (38%)
Similarity:110/249 - (44%) Gaps:84/249 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PHHSVPHGPLPPGMPMPSLGPFGLPHGLEAVGFSQGMWGVNTRKQRRERTTFTRAQLDVLEALFG 87
            ||::|      .|:.:.:.| ..|.|  .|||:.     ...||||||||||||.|||:|||||.
Zfish     8 PHYAV------NGLTLSASG-MDLLH--TAVGYP-----ATPRKQRRERTTFTRTQLDILEALFT 58

  Fly    88 KTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQ----------QQQSN---SLSSSK 139
            ||||||||||||||||||||||||||||||||||||||.||          :::|:   .|:|..
Zfish    59 KTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQTSGQPKPRPPKKKSSPPPDLTSDP 123

  Fly   140 NASGG------------------------------------GSGNSC-------SSSSANSRSNS 161
            ..|..                                    |||..|       ..|.....|.|
Zfish   124 GTSSSVVAAPTPTVPPSVSAGTAPVSVWSPTSLSPLPDPLCGSGTPCVQRPAPYPMSYGQPSSYS 188

  Fly   162 NNNGSS------------SNNNTQ--SSGGNNSNKSSQKQGNSQSSQQGGGSSG 201
            ...|||            |...||  :|||..|..:....|.|.|......|.|
Zfish   189 QGYGSSPYFSGLDCSPYLSPMTTQLSASGGALSPLTVPSMGGSLSQSPSLSSQG 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 48/51 (94%)
crxNP_694419.1 homeodomain 38..97 55/58 (95%)
Homeobox 49..94 CDD:278475 42/44 (95%)
TF_Otx 152..230 CDD:281521 17/77 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2251
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 167 1.000 Inparanoid score I4143
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm25206
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X850
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.