DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and ALX1

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_008913.2 Gene:ALX1 / 8092 HGNCID:1494 Length:326 Species:Homo sapiens


Alignment Length:145 Identity:58/145 - (40%)
Similarity:82/145 - (56%) Gaps:36/145 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQ-- 124
            |::.|:||.|||||..||:.||.:|.||.|||:::||::||:..|.|:||||||:|||||.|:  
Human   127 VSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRE 191

  Fly   125 ---QLQQ--------------------QQQSNSLSSSKNASGGGSGNSC-----SSS-----SAN 156
               |:||                    .|..|:|.:. |||||....||     :||     |.:
Human   192 RYGQIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAG-NASGGSVVTSCMLPRDTSSCMTPYSHS 255

  Fly   157 SRSNSNNNGSSSNNN 171
            .|::|:..|.|::.|
Human   256 PRTDSSYTGFSNHQN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 32/51 (63%)
ALX1NP_008913.2 Homeobox 135..189 CDD:365835 32/53 (60%)
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 192..326 21/80 (26%)
OAR 302..320 CDD:367680
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.