DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and Rhox13

DIOPT Version :10

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001171931.1 Gene:Rhox13 / 73614 MGIID:1920864 Length:232 Species:Mus musculus


Alignment Length:69 Identity:28/69 - (40%)
Similarity:47/69 - (68%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 RKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQ 129
            |::|.....|.:.|::.:|:||.:|:|||:..|.|:|..:|:||.:|:|||.|||||.|:..:::
Mouse   146 RRRRGPPFHFAQWQVEEMESLFEETQYPDLLTRGELARTLNVPEVKVKVWFTNRRAKQRKIERRE 210

  Fly   130 QQSN 133
            ...|
Mouse   211 MLRN 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeodomain 68..123 CDD:459649 25/54 (46%)
Rhox13NP_001171931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..114
Homeodomain 155..205 CDD:459649 24/49 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.