| Sequence 1: | NP_001356934.1 | Gene: | oc / 31802 | FlyBaseID: | FBgn0004102 | Length: | 664 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001171931.1 | Gene: | Rhox13 / 73614 | MGIID: | 1920864 | Length: | 232 | Species: | Mus musculus |
| Alignment Length: | 69 | Identity: | 28/69 - (40%) |
|---|---|---|---|
| Similarity: | 47/69 - (68%) | Gaps: | 0/69 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 65 RKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQ 129
Fly 130 QQSN 133 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| oc | NP_001356934.1 | Homeodomain | 68..123 | CDD:459649 | 25/54 (46%) |
| Rhox13 | NP_001171931.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 45..114 | ||
| Homeodomain | 155..205 | CDD:459649 | 24/49 (49%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||