DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and Rhox13

DIOPT Version :10

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001395833.1 Gene:Rhox13 / 691244 RGDID:1586264 Length:234 Species:Rattus norvegicus


Alignment Length:80 Identity:32/80 - (40%)
Similarity:51/80 - (63%) Gaps:4/80 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 RKQRRERTT----FTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQ 125
            |:.||.|.:    ||:.|::.:|.||.:|.|||:..|.|:|..:|:||.:|:|||.|||||.|:.
  Rat   144 RRHRRHRRSSPYLFTQWQVEEMENLFEETPYPDVLTRGELARTLNVPEVKVKVWFSNRRAKQRKN 208

  Fly   126 LQQQQQSNSLSSSKN 140
            .::....|..|.:::
  Rat   209 ERRAMLRNMPSGAED 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeodomain 68..123 CDD:459649 28/58 (48%)
Rhox13NP_001395833.1 Homeodomain 157..207 CDD:459649 25/49 (51%)

Return to query results.
Submit another query.