DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and Vax2

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_072159.1 Gene:Vax2 / 64572 RGDID:621133 Length:292 Species:Rattus norvegicus


Alignment Length:102 Identity:37/102 - (36%)
Similarity:56/102 - (54%) Gaps:16/102 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQ 125
            |::..:.:|.||:||..||..||..|.:.:|.....|.|:|.::||.|::|:|||:|||.|    
  Rat    96 GLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTK---- 156

  Fly   126 LQQQQQSNSLSSSKNASGGGSGNSCSSSSANSRSNSN 162
             |::.||..|  .|.|         |||:..:.:.||
  Rat   157 -QKKDQSRDL--EKRA---------SSSAFEAFATSN 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 24/51 (47%)
Vax2NP_072159.1 vax upstream domain 74..101 1/4 (25%)
homeobox 102..161 26/63 (41%)
Homeobox 105..158 CDD:278475 24/57 (42%)
vax downstream domain 182..193 37/102 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..241
vax terminal domain 266..274
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.