DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and alx1

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001038539.1 Gene:alx1 / 565176 ZFINID:ZDB-GENE-050419-191 Length:320 Species:Danio rerio


Alignment Length:197 Identity:64/197 - (32%)
Similarity:101/197 - (51%) Gaps:36/197 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQ-- 124
            |::.|:||.|||||.|||:.||.:|.||.|||:::||::|::..|.|:||||||:|||||.|:  
Zfish   115 VSSSKKRRHRTTFTSAQLEELEKVFQKTHYPDVYVREQLAMRTELTEARVQVWFQNRRAKWRKRE 179

  Fly   125 ---QLQQQQ-------------QSNSLSSSKNA--SGGGSGNSCSSSSANSRSNSNNNGSSSNNN 171
               |:||.:             :::|.|...|.  :|..:|:|..||....|.:.....|...::
Zfish   180 RYGQIQQAKSHFAATYDISMLPRTDSYSQISNNLWTGPSAGSSVVSSCMIPRGSPPCVTSPYPHS 244

  Fly   172 TQSSGGNNSNKSSQKQG-----NSQSSQQGGGSSGGNNSNNNS-AAAAASAAAAVAAAQSIKTHH 230
            .:::          :.|     |.|.:|.|......||...:| .|::|::.||.......:...
Zfish   245 PRAA----------EHGYVGFPNHQQNQFGVNHVSLNNFFADSLLASSANSHAAFETKPEFERRS 299

  Fly   231 SS 232
            ||
Zfish   300 SS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 32/51 (63%)
alx1NP_001038539.1 Homeobox 123..176 CDD:278475 32/52 (62%)
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 180..320 27/132 (20%)
OAR 296..313 CDD:281777 2/6 (33%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 300..313 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.