Sequence 1: | NP_001356934.1 | Gene: | oc / 31802 | FlyBaseID: | FBgn0004102 | Length: | 664 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001038539.1 | Gene: | alx1 / 565176 | ZFINID: | ZDB-GENE-050419-191 | Length: | 320 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 64/197 - (32%) |
---|---|---|---|
Similarity: | 101/197 - (51%) | Gaps: | 36/197 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 VNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQ-- 124
Fly 125 ---QLQQQQ-------------QSNSLSSSKNA--SGGGSGNSCSSSSANSRSNSNNNGSSSNNN 171
Fly 172 TQSSGGNNSNKSSQKQG-----NSQSSQQGGGSSGGNNSNNNS-AAAAASAAAAVAAAQSIKTHH 230
Fly 231 SS 232 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
oc | NP_001356934.1 | Homeobox | 71..123 | CDD:333795 | 32/51 (63%) |
alx1 | NP_001038539.1 | Homeobox | 123..176 | CDD:278475 | 32/52 (62%) |
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 | 180..320 | 27/132 (20%) | |||
OAR | 296..313 | CDD:281777 | 2/6 (33%) | ||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 300..313 | 2/2 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |