DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and otx2

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_012823826.1 Gene:otx2 / 548931 XenbaseID:XB-GENE-485220 Length:306 Species:Xenopus tropicalis


Alignment Length:261 Identity:109/261 - (41%)
Similarity:130/261 - (49%) Gaps:54/261 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GMPM--PSLG-PFGLPHGLEAVGFSQGMWGVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFM 96
            ||.:  ||:| |..| |....:..|...:....||||||||||||||||||||||.|||||||||
 Frog    21 GMDLLHPSVGYPVAL-HQSRQITCSFYDFAATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFM 84

  Fly    97 REEVALKINLPESRVQVWFKNRRAKCRQQLQQQQQ--SNSLSSSK---------NASGGGSGN-- 148
            |||||||||||||||||||||||||||||.||||.  .|.:..||         ::..|.||.  
 Frog    85 REEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPSKKKPSPAREVSSESGTSGQFS 149

  Fly   149 -SC-------SSSSAN----------------SRSNSNNNGSSSNNNTQSSGGNNSNKSSQKQGN 189
             .|       |||:|.                |.|:|....|.....||:||        ..||.
 Frog   150 PPCSTSVPVISSSTAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASG--------YSQGY 206

  Fly   190 SQSSQQGGGSSGGN-----NSNNNSAAAAASAAAAVAAAQSIKTHHSSFLSAAAAAASGGTNQSA 249
            :.|:...||...|:     :...:.|.|..|.....|....:....::..|.|..|:|.|.|.:|
 Frog   207 AGSTSYFGGMDCGSYLTPMHHQLSGAGATLSPMGTNAVTSHLNQSPAALSSQAYGASSLGFNSTA 271

  Fly   250 N 250
            :
 Frog   272 D 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 50/51 (98%)
otx2XP_012823826.1 Homeobox 59..111 CDD:365835 50/51 (98%)
TF_Otx 170..251 CDD:367546 18/88 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5877
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 165 1.000 Inparanoid score I4063
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm48232
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3028
SonicParanoid 1 1.000 - - X850
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.