DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and alx4b

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001297007.1 Gene:alx4b / 497424 ZFINID:ZDB-GENE-050208-140 Length:259 Species:Danio rerio


Alignment Length:229 Identity:47/229 - (20%)
Similarity:72/229 - (31%) Gaps:68/229 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 SIYGSAAGSNPRLLQPGGNITPMDSSSSITTPS-----------PPITPMSPQSAAAAAHAAQSA 440
            |.|..||....|:.|.....| ..||.|..:|:           .|.:|............|:.|
Zfish    17 SYYSPAAPGQGRVQQANPYRT-FQSSDSKYSPTFLPAKGQTYGEKPRSPFHQDCPTLDDSTAEGA 80

  Fly   441 QSAHH--------------SAAHSAAYMSNH----DSYNFWH-----NQYQQYPNNYAQA----- 477
            .|.:|              |.....|.:|.:    :|...|.     .|.||...:::.|     
Zfish    81 YSKYHLFMQRPACKSPSEDSKLEDGALISCYGVVSESPGKWRKRERFGQMQQVRTHFSTAYELPL 145

  Fly   478 ---PSYYSQMEYFSNQNQVNYNMGHSGYTASNFGLSPSPSFT---GTVSAQAFSQNSLDYMSPQD 536
               |..|:|::             :..:.:.:...||.|...   .|||:         .|:|..
Zfish   146 LTRPENYAQIQ-------------NPSWLSGSSSASPVPGCVVPCDTVSS---------CMTPHP 188

  Fly   537 KYANMVXNLLFQYCSGGSNNNSSAGASGSGSGSG 570
            ..|:.| :.|.....|||...:..|:....||.|
Zfish   189 HSASGVSDFLGMPSPGGSMAQTHMGSLFGSSGVG 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795
alx4bNP_001297007.1 OAR 235..252 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.