DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and repo

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster


Alignment Length:427 Identity:103/427 - (24%)
Similarity:141/427 - (33%) Gaps:140/427 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HSYGGPHPHH--SVPHGP---LPPGMPMPSLG---------PFGLPHGLEAVGFS---------- 56
            |.||| .|||  .:.||.   |....|:...|         |..:...|||.|..          
  Fly   187 HLYGG-SPHHLDHLDHGSDGLLQDSSPVMINGGSAGGKLKKPDEMCSQLEAGGAGVTPPSSSSTV 250

  Fly    57 ---------------------QGMWGV----------------------NTRKQRRERTTFTRAQ 78
                                 ||..|.                      |..|:::.|||||..|
  Fly   251 VNGTTNGTGNANSSSSAGVGIQGAAGTAGGVAAPAAKKDGSSSKKKGDPNGIKKKKTRTTFTAYQ 315

  Fly    79 LDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQQQSNSLSSSKNASG 143
            |:.||..|.:..|||:|.|||:|:|:||.||||||||:|||||.|:. :..:::..:.:|     
  Fly   316 LEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKH-EPPRKTGYIKTS----- 374

  Fly   144 GGSGNSCSSSSANSRSNSNNNGSSSNNNTQSSGGNNSNKSSQKQGNSQSSQ----QGGGSSGGNN 204
                 :..:::.|..:.:....|.....|.:..|:..:.:|.:.....:.|    ....|..|..
  Fly   375 -----TPPTATLNPGTLAPPFTSYPQTTTVTPPGSMDSWTSYQTPYELTPQFSLLSPAASPYGTY 434

  Fly   205 SNNNSAAAAASAAAAVAAAQSIKTHHSSFLSAAAAAASGGTNQSANNNSNNNNQGNSTPNSSSSG 269
            |        ....|.|..:|.....|..:.|.........|             |:...|...|.
  Fly   435 S--------GQYGAYVHESQLFPMRHYEYGSPTRMEMGATT-------------GSVAGNGDESV 478

  Fly   270 GGGGSQAGGHLSAA----AAAAALNVTAAHQ---------NSSPLLPTPATSVSPVSIVCKKEHL 321
            ..|||.....|..|    .|...|....|||         |...|   .|.....|.:.|   |.
  Fly   479 ANGGSYQTAELQTAQQQQLADGTLVTVHAHQQQQQQQQQLNGKYL---SAEEAKYVHLQC---HQ 537

  Fly   322 SGGYGSSVGGGGG----------------GGGASSGG 342
            ||| |..:..|..                ||.||:||
  Fly   538 SGG-GLELSPGASCHLVEAQGQHYVTTATGGAASAGG 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 34/51 (67%)
repoNP_477026.1 Homeobox 313..360 CDD:278475 29/46 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451026
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.