DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and Rhox10

DIOPT Version :10

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001020021.1 Gene:Rhox10 / 434769 MGIID:3580249 Length:196 Species:Mus musculus


Alignment Length:102 Identity:33/102 - (32%)
Similarity:58/102 - (56%) Gaps:9/102 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQ 125
            |..:|:...::  :|.||:..||..|.:|:|||...|:.:|..|::.|.:|:.|||.:|||.|  
Mouse    83 GAVSRRSNSKK--YTNAQMCELEKAFQETQYPDAHQRKALAKLIDVDECKVKAWFKYKRAKYR-- 143

  Fly   126 LQQQQQSNSLSSSKNASGGGSGNSCSSSSANSRSNSN 162
               ::|...|.|  ||:.|.|.|..:..:.:.:|:::
Mouse   144 ---RKQKELLLS--NATSGTSNNFSAQMNEDPKSSTS 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeodomain 68..123 CDD:459649 21/54 (39%)
Rhox10NP_001020021.1 Homeodomain 94..144 CDD:459649 22/54 (41%)

Return to query results.
Submit another query.