DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and Antp

DIOPT Version :10

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:149 Identity:43/149 - (28%)
Similarity:67/149 - (44%) Gaps:29/149 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GFLKSGDLGPHPHSYGGPHPHHSVPHGPLP----PGMPMPSLGPFGLPHGLEAVGFSQGMWGVNT 64
            |.:..|. || |..:.| ||....|....|    .|||.| |.|           :.:..:| ..
  Fly   246 GMMHQGQ-GP-PQMHQG-HPGQHTPPSQNPNSQSSGMPSP-LYP-----------WMRSQFG-KC 294

  Fly    65 RKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQ 129
            ::::|.|.|:||.|...||..|...||.....|.|:|..:.|.|.::::||:|||.|.:::.:.:
  Fly   295 QERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTK 359

  Fly   130 QQSNSLSSSKNASGGGSGN 148
            .:..|         ||.|:
  Fly   360 GEPGS---------GGEGD 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeodomain 68..123 CDD:459649 22/54 (41%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 20/75 (27%)
Homeodomain 298..354 CDD:459649 22/55 (40%)

Return to query results.
Submit another query.