DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and mix1

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_988848.1 Gene:mix1 / 394439 XenbaseID:XB-GENE-485898 Length:357 Species:Xenopus tropicalis


Alignment Length:170 Identity:55/170 - (32%)
Similarity:78/170 - (45%) Gaps:45/170 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PHGPLPPGMPMPSLGPFGLPHGLEAVGFSQGMWGVNTRKQRRERTTFTRAQLDVLEALFGKTRYP 92
            |..|:|....:|:                         .|||:||.||:||||:||..|....||
 Frog    73 PRNPVPDASLLPA-------------------------SQRRKRTFFTQAQLDILEQFFQTNMYP 112

  Fly    93 DIFMREEVALKINLPESRVQVWFKNRRAKCRQQ--------LQQQQQSNSLSSSKNA-SGGGSGN 148
            ||..|||:|..|.:||||:||||:|||||.|:|        |.....|::..::::. ....:.|
 Frog   113 DIHHREELARHIYIPESRIQVWFQNRRAKVRRQGAKATKPVLAGHHYSSTFGATRSMFPSAPAPN 177

  Fly   149 SCSSSSANSRSNSNNNGSSSNNNTQSSGGNNSNKSSQKQG 188
            |.|...|.:|:.:           |....:.:||..|.||
 Frog   178 SSSHPMATARAQA-----------QPMKDSQANKFHQSQG 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 33/51 (65%)
mix1NP_988848.1 Homeobox 90..143 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.