DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and eyg

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001014582.1 Gene:eyg / 39419 FlyBaseID:FBgn0000625 Length:670 Species:Drosophila melanogaster


Alignment Length:446 Identity:107/446 - (23%)
Similarity:151/446 - (33%) Gaps:146/446 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAGFLKSGDLG---PHPHSYGG--PHPHHSVPHG-----PLPP--------------------G 35
            :|..|.::...|   |.||.||.  .||..:||.|     |.||                    .
  Fly   224 VATEFARTAAYGLYPPPPHPYGSFTWHPAGNVPGGQGVPPPPPPSALWSVAAPTLANLPPSAASA 288

  Fly    36 MPMPSLGPFGLPHGLEAVG---------FSQGMWGVNT--------------------RKQRRER 71
            :|:.:.|.....| |.|.|         .|.|....:|                    .|.||.|
  Fly   289 VPVSTCGSLSSAH-LMAGGAGGTPTNRAISPGSGSHDTLESADENRHIDSDYLDDDDEPKFRRNR 352

  Fly    72 TTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQQQSNSLS 136
            |||:..||:.||..|.|:.||.:..||.::.:.:|.|:||||||.|||||.|:..:........|
  Fly   353 TTFSPEQLEELEKEFDKSHYPCVSTRERLSSRTSLSEARVQVWFSNRRAKWRRHQRMNLLKRQRS 417

  Fly   137 SSKNASGGGSGNSCSSSSANSRSNSNNNGSS---------------------------------- 167
            |..|.......|...:||....::|:.:.|:                                  
  Fly   418 SPANPLHSQQSNDAPASSPTPSNHSSASTSAPVAPVPPPQQPLPLCGDHSPQGPPPSVLLHPLHG 482

  Fly   168 -----------------------SNNNTQSSGGNNSNKSSQKQGNSQSSQQGGGSS--------- 200
                                   |:.:.|...........|:|.:.|..||...|.         
  Fly   483 PPGGHHHHHPLHLPTHPAALQLLSHYHQQQQQQQQQQHQQQQQQHHQQQQQLSPSGCNPAANHLS 547

  Fly   201 -GGNNSNNNSAAAAASAAA--------AVAAAQSIKTHHSSFLS-AAAAAASGGTNQSANNNSNN 255
             ||..|...|..::.||||        ||||:.::.....|.|. :|....|||.....|.|:..
  Fly   548 MGGERSAFRSLVSSPSAAAFLGLARQYAVAASLTVAEEQRSRLHYSAGGLGSGGEGTGPNTNTTQ 612

  Fly   256 NNQGNSTPNSSSSGG----GGGSQAGGHLSAAAAAAALNVTAAHQNSSPLLPTPAT 307
            :.....|.::|||..    .....:.|.:.::||.||   ..|..:||   ..|||
  Fly   613 SGGSTMTVDNSSSDSDEEINVHDDSDGEIESSAATAA---KVARLSSS---DAPAT 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 27/51 (53%)
eygNP_001014582.1 HTH 120..217 CDD:304362
Homeobox 352..404 CDD:278475 27/51 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450830
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.