Sequence 1: | NP_001356934.1 | Gene: | oc / 31802 | FlyBaseID: | FBgn0004102 | Length: | 664 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014582.1 | Gene: | eyg / 39419 | FlyBaseID: | FBgn0000625 | Length: | 670 | Species: | Drosophila melanogaster |
Alignment Length: | 446 | Identity: | 107/446 - (23%) |
---|---|---|---|
Similarity: | 151/446 - (33%) | Gaps: | 146/446 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MAAGFLKSGDLG---PHPHSYGG--PHPHHSVPHG-----PLPP--------------------G 35
Fly 36 MPMPSLGPFGLPHGLEAVG---------FSQGMWGVNT--------------------RKQRRER 71
Fly 72 TTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQQQSNSLS 136
Fly 137 SSKNASGGGSGNSCSSSSANSRSNSNNNGSS---------------------------------- 167
Fly 168 -----------------------SNNNTQSSGGNNSNKSSQKQGNSQSSQQGGGSS--------- 200
Fly 201 -GGNNSNNNSAAAAASAAA--------AVAAAQSIKTHHSSFLS-AAAAAASGGTNQSANNNSNN 255
Fly 256 NNQGNSTPNSSSSGG----GGGSQAGGHLSAAAAAAALNVTAAHQNSSPLLPTPAT 307 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
oc | NP_001356934.1 | Homeobox | 71..123 | CDD:333795 | 27/51 (53%) |
eyg | NP_001014582.1 | HTH | 120..217 | CDD:304362 | |
Homeobox | 352..404 | CDD:278475 | 27/51 (53%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45450830 | |
Domainoid | 1 | 1.000 | 55 | 1.000 | Domainoid score | I4097 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.840 |