DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and exex

DIOPT Version :10

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster


Alignment Length:173 Identity:58/173 - (33%)
Similarity:76/173 - (43%) Gaps:54/173 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PHS---------YGGPHPHH------SVPHGPL-PPGMPMPSLGPFG---LPHGLEAVGFSQ-GM 59
            |||         |.|.||:.      |..|.|| |.|.|:|.  |.|   :|..|:....:: ||
  Fly   357 PHSPIRPQDFPLYAGGHPYQLLAQGGSAFHRPLDPSGKPIPI--PMGHNFMPSQLQFEFLARAGM 419

  Fly    60 WGVNTR--------------KQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESR 110
              ::.|              |.||.||.||..||..||..|.:.:|.....|.|||..:.|.|::
  Fly   420 --LHHRIPELAAYPHHAILGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQ 482

  Fly   111 VQVWFKNR----------------RAKCRQQLQQQQQSNSLSS 137
            |::||:||                |||..||.|||||:.|.:|
  Fly   483 VKIWFQNRRMKWKRSKKAQQEAKERAKANQQQQQQQQTPSAAS 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeodomain 68..123 CDD:459649 26/70 (37%)
exexNP_648164.1 Homeodomain 440..496 CDD:459649 23/55 (42%)

Return to query results.
Submit another query.