DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and gsb-n

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster


Alignment Length:443 Identity:101/443 - (22%)
Similarity:146/443 - (32%) Gaps:187/443 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 RKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQ 129
            |||||.|||||..||:.||..|.:|:|||::.|||:|....|.|:|:||||.||||:.|:.    
  Fly   180 RKQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRKH---- 240

  Fly   130 QQSNSLSSSKNASGGGSGNSCSSSSANSRSNSNNNGSSSNNNTQSSGGNNSNKSSQKQGNSQSSQ 194
                                                         |||:||..|....|:|... 
  Fly   241 ---------------------------------------------SGGSNSGLSPMNSGSSNVG- 259

  Fly   195 QGGGSSGGNNSNNNSAAAAASAAAAVAAAQSIKTHHSSFLSAAAAAASGGTNQSANNNSNNNNQG 259
            .|.|.||.............|.|....|..:         :|..|..:.|.:.:|:         
  Fly   260 VGVGLSGATAPLGYGPLGVGSMAGYSPAPGT---------TATGAGMNDGVHHAAH--------- 306

  Fly   260 NSTPNSSSSGGGGGSQAGGHLSAAAAAAALNVTAAHQNSSPLLPTPATSVSPVSIVCKKEHLSGG 324
              .|:|             |.|||.|||     |||.::.                      .||
  Fly   307 --APSS-------------HHSAATAAA-----AAHHHTQ----------------------MGG 329

  Fly   325 YG---SSVGGGGGGGGASSGGLNLGVGVGVGVGVGVGVSQDLLRSPYDQLKDAGGDIGAGVHHHH 386
            |.   |:...|..||.|..|...               ||:.....|.:|               
  Fly   330 YDLVQSAAQHGFPGGFAQPGHFG---------------SQNYYHQDYSKL--------------- 364

  Fly   387 SIYGSAAGSNPRLLQPGGNITPMDSSSSITTPSPPITPMSPQSAAAAAHAAQSA-----QSAHHS 446
                                 .:|..|.:|..|  ::.:||....:..::...|     |:|:|:
  Fly   365 ---------------------TIDDFSKLTADS--VSKISPSLHLSDNYSKLEAPSNWSQAAYHA 406

  Fly   447 AAHSAAYMSNHDSYNFWHNQYQQYPNNYAQAPSYYSQMEYFSN----QNQVNY 495
            ||:..|:::.|..            |:||.|.::.:....:|:    |.|..|
  Fly   407 AANYNAHVAQHQL------------NDYAAAAAHGNPASAYSHPLPTQGQAKY 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 29/51 (57%)
gsb-nNP_523862.1 PAX 20..141 CDD:278709
Homeobox 185..238 CDD:278475 29/52 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450998
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.