DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and CG9876

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster


Alignment Length:117 Identity:50/117 - (42%)
Similarity:63/117 - (53%) Gaps:25/117 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SGDLGPHPHSYGGPHPHHSVPHGPLPPGMPMPSLGPFGLPHGLEAVGFSQGMWGVNTRKQRRERT 72
            |.:.||.....||             ...|.|..|  .||.|          .|.::||.||.||
  Fly    83 SSNFGPTGAGCGG-------------ADRPAPCSG--NLPAG----------GGHHSRKPRRNRT 122

  Fly    73 TFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQ 124
            ||:.|||..||.:|.:|.|||.|:|||:|.|::|.|:||||||:|||||.|:
  Fly   123 TFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRR 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 33/51 (65%)
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450907
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.