DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and CG9876

DIOPT Version :10

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster


Alignment Length:117 Identity:50/117 - (42%)
Similarity:63/117 - (53%) Gaps:25/117 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SGDLGPHPHSYGGPHPHHSVPHGPLPPGMPMPSLGPFGLPHGLEAVGFSQGMWGVNTRKQRRERT 72
            |.:.||.....||             ...|.|..|  .||.|          .|.::||.||.||
  Fly    83 SSNFGPTGAGCGG-------------ADRPAPCSG--NLPAG----------GGHHSRKPRRNRT 122

  Fly    73 TFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQ 124
            ||:.|||..||.:|.:|.|||.|:|||:|.|::|.|:||||||:|||||.|:
  Fly   123 TFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRR 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeodomain 68..123 CDD:459649 35/54 (65%)
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 35/55 (64%)

Return to query results.
Submit another query.