DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and Alx3

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001007013.2 Gene:Alx3 / 365900 RGDID:1359270 Length:343 Species:Rattus norvegicus


Alignment Length:217 Identity:70/217 - (32%)
Similarity:93/217 - (42%) Gaps:76/217 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DLGPHP-----HSY------------------------GGPHPHHSVPHGPLPPGMPMPSLG-PF 44
            ||||.|     |.|                        |||....|...|  .||..:.||. |.
  Rat    74 DLGPGPVLNGGHFYKGSSEAEEKASKAASFPQLPVDCRGGPRDGPSNVQG--SPGPCLASLSVPL 136

  Fly    45 --GLPHGLEAVGFSQGMWGVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLP 107
              |||..:|.        ..:..|:||.||||:..||:.||.:|.||.|||::.||::||:.:|.
  Rat   137 SPGLPDSMEL--------AKSKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLT 193

  Fly   108 ESRVQVWFKNRRAKCRQ-----QLQQ--------------------QQQSNSLSSS--KNASGG- 144
            |:||||||:|||||.|:     ::|:                    .|..|||.||  ..:.|| 
  Rat   194 EARVQVWFQNRRAKWRKRERYGKIQEGRNPFTTAYDISVLPRTDSHPQLQNSLWSSPGSGSPGGP 258

  Fly   145 ------GSGNSCSSSSANSRSN 160
                  |..:.|.|..::|..|
  Rat   259 CLMPPEGIPSPCMSPYSHSHGN 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 31/51 (61%)
Alx3NP_001007013.2 Homeobox 157..210 CDD:395001 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.