Sequence 1: | NP_001356934.1 | Gene: | oc / 31802 | FlyBaseID: | FBgn0004102 | Length: | 664 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001007013.2 | Gene: | Alx3 / 365900 | RGDID: | 1359270 | Length: | 343 | Species: | Rattus norvegicus |
Alignment Length: | 217 | Identity: | 70/217 - (32%) |
---|---|---|---|
Similarity: | 93/217 - (42%) | Gaps: | 76/217 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 DLGPHP-----HSY------------------------GGPHPHHSVPHGPLPPGMPMPSLG-PF 44
Fly 45 --GLPHGLEAVGFSQGMWGVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLP 107
Fly 108 ESRVQVWFKNRRAKCRQ-----QLQQ--------------------QQQSNSLSSS--KNASGG- 144
Fly 145 ------GSGNSCSSSSANSRSN 160 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
oc | NP_001356934.1 | Homeobox | 71..123 | CDD:333795 | 31/51 (61%) |
Alx3 | NP_001007013.2 | Homeobox | 157..210 | CDD:395001 | 31/52 (60%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |