DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and otx5

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_851848.2 Gene:otx5 / 353179 ZFINID:ZDB-GENE-030508-1 Length:289 Species:Danio rerio


Alignment Length:318 Identity:122/318 - (38%)
Similarity:150/318 - (47%) Gaps:84/318 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PHHSVPHGPLPPGMPMPSLGPFGLPHGLEAVGFSQGMWGVNT-RKQRRERTTFTRAQLDVLEALF 86
            ||:||      .|:.:...| ..|.|  .|||:.      || ||||||||||||||||||||||
Zfish     8 PHYSV------NGLTLTGTG-MDLLH--SAVGYP------NTPRKQRRERTTFTRAQLDVLEALF 57

  Fly    87 GKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQQQS----------------NSL 135
            .|||||||||||||||||||||||||||||||||||||| ||||.|                :|.
Zfish    58 SKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQ-QQQQTSGQTKPRPPKKKSSPARDSS 121

  Fly   136 SSSKNASGGG--------SGNSCSSSSANSRSNSNNNGSSSNNNTQSSGGNNS--NKSSQKQGNS 190
            :|..:||..|        .|.:.:.||:::..:..:..|.|......|..:.:  .:||.....|
Zfish   122 ASEPSASTSGPYSPPPPPPGTAITPSSSSATVSIWSPASISPLPDPLSAPSTACLQRSSYPMTYS 186

  Fly   191 QSSQQGGGSSGGNNSNNNSAAAAASAAAAVAAAQSIKTHHSSFLSAAAAA---ASGGTNQSANNN 252
            |:...|           .|.||::|....:..:..:...|.. |||:..|   .||..:||    
Zfish   187 QAPAYG-----------QSYAASSSYFTGLDCSSYLSPMHPQ-LSASGGALSPMSGALSQS---- 235

  Fly   253 SNNNNQGNSTPNSSSSGGGGGSQAG-GHLSA-----AAAAAALNVTAA------HQNS 298
                      |.|.||.|...:..| |.:..     ..:|..||..||      .|||
Zfish   236 ----------PASLSSQGYTAASLGFGTVDCLDYKDQTSAWKLNFNAADCLDYKDQNS 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 50/51 (98%)
otx5NP_851848.2 Homeobox 42..94 CDD:278475 50/51 (98%)
TF_Otx 157..231 CDD:281521 18/85 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5917
eggNOG 1 0.900 - - E1_KOG2251
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 167 1.000 Inparanoid score I4143
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm25206
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X850
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.