DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment oc and LEUTX

DIOPT Version :9

Sequence 1:	NP_001356934.1	Gene:	oc / 31802	FlyBaseID:	FBgn0004102	Length:	664	Species:	Drosophila melanogaster
Sequence 2:	NP_001369274.1	Gene:	LEUTX / 342900	HGNCID:	31953	Length:	198	Species:	Homo sapiens

Alignment Length:	134	Identity:	44/134 - (32%)
Similarity:	68/134 - (50%)	Gaps:	4/134 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly    65 RKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKC-RQQLQQ 128
            |:.||.||.|...||..|..|..||.:|.:....::|.|:.|..|.|::||||:|||. |||.||
Human     6 RRYRRPRTRFLSKQLTALRELLEKTMHPSLATMGKLASKLQLDLSVVKIWFKNQRAKWKRQQRQQ 70

  Fly   129 QQQSNSLSSSKNASGGGSGNSCSS-SSANSRSNSNNNGSSSNNNTQSSGG--NNSNKSSQKQGNS 190
            .|...||..:...:......:.|: ::||.|..|.....:::::.:...|  |....|:..:.:|
Human    71 MQTRPSLGPANQTTSVKKEETPSAITTANIRPVSPGISDANDHDLREPSGIKNPGGASASARVSS 135

  Fly   191 QSSQ 194
            ..||
Human   136 WDSQ 139

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
oc	NP_001356934.1	Homeobox	71..123	CDD:333795	22/52 (42%)
LEUTX	NP_001369274.1	HOX	15..64	CDD:197696	20/48 (42%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	65..133		16/67 (24%)
		LEUTX region. /evidence=ECO:0000303\|PubMed:30479355	79..190		11/61 (18%)
		9aaTAD. /evidence=ECO:0000303\|PubMed:30479355	125..136		1/10 (10%)
		9aaTAD. /evidence=ECO:0000303\|PubMed:30479355	153..161
		9aaTAD. /evidence=ECO:0000303\|PubMed:30479355	163..171
		9aaTAD. /evidence=ECO:0000303\|PubMed:30479355	178..186
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG2251
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900