DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and Gsc

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster


Alignment Length:166 Identity:70/166 - (42%)
Similarity:93/166 - (56%) Gaps:26/166 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AAGFLKSGDLGPHPHSYGGPHPHHSVPH-GPLPPGMPMPSLGPFGLPHGLEAVGFSQGMWGVNTR 65
            |||.  ||. |.|||...| ||||  || |....|.           |.|..:|.     |...:
  Fly   296 AAGL--SGH-GHHPHHPHG-HPHH--PHLGAHHHGQ-----------HHLSHLGH-----GPPPK 338

  Fly    66 KQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQQ 130
            ::||.||.||..||:.|||.|.||.|||:.:||::|||::|.|.||:|||||||||.|:|.:::|
  Fly   339 RKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKREEQ 403

  Fly   131 QSNSLSSSKNASGGGSGNSCSSSSANSRSNSNNNGS 166
            :  .|...:....|.:.|..::||:.:.| |..|||
  Fly   404 E--RLRKLQEEQCGSTTNGTTNSSSGTTS-STGNGS 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 33/51 (65%)
GscNP_001137762.2 Homeobox 343..396 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451033
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.