DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and CG11294

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001259352.1 Gene:CG11294 / 31807 FlyBaseID:FBgn0030058 Length:261 Species:Drosophila melanogaster


Alignment Length:264 Identity:89/264 - (33%)
Similarity:122/264 - (46%) Gaps:67/264 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GPF--GLPHGLEAVGFSQGMWGVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKI 104
            |||  .||..|    .::.|:|  .|:|||.|||||..||..|||||.||.|||:|:||||||:|
  Fly     3 GPFISPLPGDL----LTEYMFG--RRRQRRNRTTFTPQQLQELEALFQKTHYPDVFLREEVALRI 61

  Fly   105 NLPESRVQVWFKNRRAKCRQQ-----LQQQQQSNSLS-SSKNASGGGSGNSCSSSSANSRSNS-- 161
            :|.|:||||||:|||||.|:|     ||...:...|| .:....|||:....|.:.|.:|..|  
  Fly    62 SLSEARVQVWFQNRRAKWRKQARLQLLQDAWRMRCLSLGTPPVMGGGAVQGGSGNGATARPPSQT 126

  Fly   162 -NNNGSSSNNNTQSSGGNNSNKSS---------------QKQGNSQSSQQ--------------- 195
             .|..|:|.::..:..||..|..|               |.||:.|::.|               
  Fly   127 PENLSSASKDSELAEVGNGPNSGSFTMMHPAFQQQHQQQQHQGHQQATDQDKLSKTYTELKLYKA 191

  Fly   196 -------GG-----GSSGGNNSNNNSAAAAASAAAAVAAAQSIKTHHSSFL--------SAAAAA 240
                   ||     |.|...:..::|.....::.|.:..:||.|.......        :|.:|.
  Fly   192 PSHGMELGGMAALSGHSDEGSDGSDSEEIDLTSGACIDFSQSSKLQQQQQQQQQQGTQGAAGSAE 256

  Fly   241 ASGG 244
            |:||
  Fly   257 ANGG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 38/51 (75%)
CG11294NP_001259352.1 Homeobox 29..80 CDD:278475 37/50 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451017
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.