DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and Vsx2

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster


Alignment Length:487 Identity:121/487 - (24%)
Similarity:170/487 - (34%) Gaps:180/487 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HPH-SYGGP---------HPHHSVPHGPLPPGMPMPSLGPFG------LP-------HGLEAV-G 54
            ||| :.|||         ||||  ||.||......|.|..|.      ||       .|:|:: |
  Fly   154 HPHGAVGGPPPPPPMQHHHPHH--PHHPLLHAQGFPQLKSFAAGAGTCLPGSLAPKDFGMESLNG 216

  Fly    55 FSQGMWGVNTRKQRR-ERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNR 118
            |..|......:|:|| .||.||..||:.||..|.:..|||::.||.::||..|||.|:||||:||
  Fly   217 FGVGPNSKKKKKKRRHSRTIFTSYQLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVWFQNR 281

  Fly   119 RAKCR--------------------------------------------------QQLQQQQQSN 133
            |||.|                                                  |:...::...
  Fly   282 RAKWRKTEKVWGGSTIMAEYGLYGAMVRHSLPLPDTILKSAKDNDAVAPWLLGMEQKCMHRKSIE 346

  Fly   134 SLSSSKNASG-------GGS-----------------------------GNSC---SSSSANSRS 159
            :.|:.|:.||       .||                             .:||   :|:||...|
  Fly   347 AQSALKDDSGVSDHEDSAGSKSAHSEDLSRSRCHALSSSTESLNVVSPAPSSCPTSASTSAPPTS 411

  Fly   160 NSNNNGSSSNNNTQSSGGNNSNKSS-----------QKQGNSQSSQQ---------GGGS--SGG 202
            .|...|::|:..|..:|.:.:|.||           |:|.:.|..||         |.|:  :|.
  Fly   412 TSGYAGAASSAATTPTGASTTNSSSSPHIELGSPSPQQQQHLQLQQQQQQQASLYLGAGAVVTGC 476

  Fly   203 NNSNNNSAAAAASAAAAVAAAQSIKTHHSSFLSAAAAAASGGTNQSANNNSNNNNQGNSTP---- 263
            ...:.:....||:||.|.|||.|...|  ..::.|.|||:....|..........|..:|.    
  Fly   477 APPSYHPLLDAANAAGAGAAASSKDFH--MIMNTAVAAAAAAAQQQHQQQQQQQQQATATAPGLH 539

  Fly   264 -----------------NSS---------------SSGGGGGSQ----AGGHLSAAAAAAALNVT 292
                             |:|               .:.||...|    |.|.......:..|.::
  Fly   540 AHNLAAALMEHDPDAFRNNSIACLRAKAQEHQARLLNNGGLFLQVRRFAQGQAQIQDPSDMLKLS 604

  Fly   293 AAHQNSSPLLPTPATSVSPVSIVCKKEHLSGG 324
            ..|.|:||:...||.|.....:..|.|..:.|
  Fly   605 EEHNNNSPIPIPPAHSTVNTQVNVKMELTANG 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 29/51 (57%)
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 29/52 (56%)
OAR 556..570 CDD:281777 2/13 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450973
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.