DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and Otx2

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_038949211.1 Gene:Otx2 / 305858 RGDID:1305705 Length:297 Species:Rattus norvegicus


Alignment Length:322 Identity:115/322 - (35%)
Similarity:144/322 - (44%) Gaps:80/322 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PP----GMPMPSLGPFGLPHGLEAVGFSQGMW----GVNTRKQRRERTTFTRAQLDVLEALFGKT 89
            ||    |:.:.:.| ..|.|  .:||: .|.|    ....||||||||||||||||||||||.||
  Rat     8 PPYAVNGLSLTTSG-MDLLH--PSVGY-PGPWASCPAATPRKQRRERTTFTRAQLDVLEALFAKT 68

  Fly    90 RYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQQQSNSLSSSKNASGGGSGNSCSSSS 154
            ||||||||||||||||||||||||||||||||||||.||||                        
  Rat    69 RYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQ------------------------ 109

  Fly   155 ANSRSNSNNNGSSSNNNTQSSGGNNSNKSSQKQGN--SQSSQQGGGSSGGNNSNNNSAAAAASAA 217
                                :||.|..:.::|:.:  .:.|.:.|.|......::.|....||::
  Rat   110 --------------------NGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSS 154

  Fly   218 AAVAAAQSIKTHHSSFLSAAAAAASGGTNQSANNNSNNNNQGNSTPNSSSSGGGGGSQAGGHLSA 282
            |.|    ||.:..|....:...:.|....|.:...:.....|.|...:.|:...||...|.:|  
  Rat   155 APV----SIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYL-- 213

  Fly   283 AAAAAALNVTAAHQNSSPLLPTPATSVSPVSIVCKKEHLSGGYGSSVGGGGGGGGASSGGLN 344
                     |..|..    ||.|..::||:.......||:   .|.......|.||||.|.|
  Rat   214 ---------TPMHHQ----LPGPGATLSPMGTNAVTSHLN---QSPASLSTQGYGASSLGFN 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 50/51 (98%)
Otx2XP_038949211.1 Homeobox 50..102 CDD:395001 50/51 (98%)
TF_Otx 163..242 CDD:397546 19/96 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2251
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.