DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and otx2b

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_571326.1 Gene:otx2b / 30501 ZFINID:ZDB-GENE-980526-406 Length:289 Species:Danio rerio


Alignment Length:308 Identity:106/308 - (34%)
Similarity:138/308 - (44%) Gaps:81/308 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PP----GMPMPSLGPFGLPHGLEAVGFSQGMWGVNTRKQRRERTTFTRAQLDVLEALFGKTRYPD 93
            ||    |:.:.:.| ..|.|  .:||:.     ...||||||||||||||||||||||.||||||
Zfish     8 PPYTVNGLSLTTSG-MDLLH--PSVGYP-----ATPRKQRRERTTFTRAQLDVLEALFAKTRYPD 64

  Fly    94 IFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQQQSNSLSSSKNASGGGSGNSCSSSSANSR 158
            ||||||||||||||||||||||||||||||||.||||                            
Zfish    65 IFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQ---------------------------- 101

  Fly   159 SNSNNNGSSSNNNTQSSGGNNSNKSSQKQGNSQSSQQGGGSSGGNNSNNNSAAAAASAAAAVAAA 223
                            :||.|..:.::|:  |..:::....||.:......::.:..|.:...|.
Zfish   102 ----------------NGGQNKVRPAKKK--SSPAREASSESGASGQFTPPSSTSVPAISTTTAP 148

  Fly   224 QSIKTHHSSFLSAAAAAASGGTNQSANNNSNNNNQGNSTPNSSSSGGGGGSQAGGHLSAAAAAAA 288
            .||.:..|....:...:.|....|.:...:.....|.|...:.|:...||...|.:|        
Zfish   149 VSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYL-------- 205

  Fly   289 LNVTAAHQNSSPLLPTPATSVSPVSIVCKKEHL--------SGGYGSS 328
               |..|..    |..|.:::||:|......||        :.|||:|
Zfish   206 ---TPMHHQ----LTGPGSTLSPMSSNAVTSHLNQSPASLPTQGYGAS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 50/51 (98%)
otx2bNP_571326.1 Homeobox 42..94 CDD:395001 50/51 (98%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..142 15/94 (16%)
TF_Otx 155..234 CDD:397546 19/93 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5917
eggNOG 1 0.900 - - E1_KOG2251
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 167 1.000 Inparanoid score I4143
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm25206
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3028
SonicParanoid 1 1.000 - - X850
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.940

Return to query results.
Submit another query.