DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and rx3

DIOPT Version :10

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_571302.1 Gene:rx3 / 30474 ZFINID:ZDB-GENE-990415-238 Length:292 Species:Danio rerio


Alignment Length:83 Identity:46/83 - (55%)
Similarity:56/83 - (67%) Gaps:0/83 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 RKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQ 129
            :|.||.|||||..||..||..|.|:.|||::.|||:|||:||||.||||||:|||||.|:|.:.:
Zfish   104 KKHRRNRTTFTTFQLHELERAFEKSHYPDVYSREELALKVNLPEVRVQVWFQNRRAKWRRQEKLE 168

  Fly   130 QQSNSLSSSKNASGGGSG 147
            ..|..|..|...|...||
Zfish   169 VSSIKLQESSMLSIPRSG 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeodomain 68..123 CDD:459649 37/54 (69%)
rx3NP_571302.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Octapeptide motif 32..39
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..72
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..107 1/2 (50%)
Homeodomain 107..163 CDD:459649 37/55 (67%)
OAR 268..284 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 272..285
Nuclear localization signal. /evidence=ECO:0000255 278..282
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.