DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and rx2

DIOPT Version :10

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_571301.2 Gene:rx2 / 30473 ZFINID:ZDB-GENE-990415-237 Length:327 Species:Danio rerio


Alignment Length:74 Identity:41/74 - (55%)
Similarity:52/74 - (70%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 RKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQ 129
            :|.||.|||||..||..||..|.|:.|||::.|||:|:|:||||.||||||:|||||.|:|.:..
Zfish   133 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKMD 197

  Fly   130 QQSNSLSSS 138
            ..:..|..|
Zfish   198 TGTMKLHDS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeodomain 68..123 CDD:459649 36/54 (67%)
rx2NP_571301.2 Octapeptide motif 37..44
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..73
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..139 3/5 (60%)
Homeodomain 136..192 CDD:459649 36/55 (65%)
OAR 302..316 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 304..317
Nuclear localization signal. /evidence=ECO:0000255 310..314
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.