DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and mixl1

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_571015.3 Gene:mixl1 / 30115 ZFINID:ZDB-GENE-000208-20 Length:327 Species:Danio rerio


Alignment Length:274 Identity:72/274 - (26%)
Similarity:112/274 - (40%) Gaps:65/274 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQQQS 132
            ||:||.||:.|:||||.::..|:||||::||::.....|||||:||||:|||||.|:|:.     
Zfish    59 RRKRTNFTQQQIDVLEKVYLDTKYPDIYLREKLEALTGLPESRIQVWFQNRRAKSRRQVG----- 118

  Fly   133 NSLSSSKNASGGGSGNSCSSSSANSRSNSNNNGSSSNNNTQSSGGNNSNKSSQKQGNSQSSQQGG 197
               .|..|.:   |||..:.::......:.:...|...|.|.:....::...|:..|  ||::..
Zfish   119 ---ISIPNKT---SGNILTPNNLLMHQFTTHQNHSGLENLQRTSTFTADSFHQQLIN--SSEEKI 175

  Fly   198 GSSGGNNSNNNSAAAAASAAAAVAAAQSIKTHHSSFLSAAAAAASGGTNQ----------SANNN 252
            .:..|:..:..:.....|.    .....|||.|.|     .......|.|          |||:.
Zfish   176 STIKGDIYDPTTIPCMFSR----TQENPIKTDHLS-----VVVPRSYTQQYPKEHEQFTHSANHA 231

  Fly   253 SNNNNQ-----GNSTPNSSSSGGGGGSQAGGHLSAAAAAAALNVTAAHQNSSPLLPTPA----TS 308
            .:...|     .|..||.:         .|..:....               |.||:.:    :|
Zfish   232 KSTMKQFLVEYDNFPPNKT---------IGPEMKVVI---------------PPLPSQSNFMMSS 272

  Fly   309 VSPVSIVCKKEHLS 322
            .||..|.|..:::|
Zfish   273 SSPKHIACSVQNMS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 30/51 (59%)
mixl1NP_571015.3 Homeobox 61..114 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.