DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and Obox2

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_038953187.1 Gene:Obox2 / 292574 RGDID:1307972 Length:326 Species:Rattus norvegicus


Alignment Length:174 Identity:51/174 - (29%)
Similarity:80/174 - (45%) Gaps:15/174 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQ- 125
            |..||:|:|||.::..|..||:..|.:.:|||..:..|:|..|.:.|..::|||||.||||:|: 
  Rat   104 VAPRKRRKERTQYSEKQKSVLQEHFAECQYPDKKLCLELASLIRVTEKEIKVWFKNNRAKCKQKN 168

  Fly   126 -----LQQQQQSNSLSSSKN------ASGGGSGNSCSSSSANSRSNSNNN---GSSSNNNTQSSG 176
                 .::...|.::|.|.:      ..||..|...:::..:..|....|   .||.:.|....|
  Rat   169 VPEALPEKNGGSEAVSGSTDFPGSIAVVGGDQGEPMATAILDVDSTPKLNCSQESSLDGNWTYDG 233

  Fly   177 GNNSNKSSQKQGNSQSSQQGGGSSGGNNSNNNSAAAAASAAAAV 220
            ...........||:..:....|.|....:.::.|||.|..|.||
  Rat   234 AMCCLPEDLLDGNAPVTAGDFGESAPVEAQSDLAAAGAPVAMAV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 21/51 (41%)
Obox2XP_038953187.1 HOX 109..165 CDD:197696 23/55 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.