DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and Prrx2

DIOPT Version :10

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_006497869.1 Gene:Prrx2 / 20204 MGIID:98218 Length:259 Species:Mus musculus


Alignment Length:115 Identity:47/115 - (40%)
Similarity:61/115 - (53%) Gaps:17/115 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PFGLPHGLEAVGF-----SQGMWGVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVAL 102
            |.|...|.||...     |.|......:||||.||||..:||..||.:|.:|.|||.|:|||:|.
Mouse    69 PSGGSSGSEAAPQDGDCPSPGRGTKRKKKQRRNRTTFNSSQLQALERVFERTHYPDAFVREELAR 133

  Fly   103 KINLPESRV------------QVWFKNRRAKCRQQLQQQQQSNSLSSSKN 140
            ::||.|:||            ||||:|||||.|:..:....:.|.|..|:
Mouse   134 RVNLSEARVQSTRPCSPHSPSQVWFQNRRAKFRRNERAMLATRSASLLKS 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeodomain 68..123 CDD:459649 34/66 (52%)
Prrx2XP_006497869.1 Homeodomain 103..167 CDD:459649 31/63 (49%)
OAR 233..249 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.