DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and Prop1

DIOPT Version :10

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_032962.1 Gene:Prop1 / 19127 MGIID:109330 Length:223 Species:Mus musculus


Alignment Length:106 Identity:44/106 - (41%)
Similarity:58/106 - (54%) Gaps:18/106 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PSLGP-FGLPHGLEAVGFSQGMWGVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVAL 102
            |.|.| .|.||                 .:||.||||..|||:.||:.||:.:||||:.||.:|.
Mouse    54 PKLCPQRGRPH-----------------SRRRHRTTFNPAQLEQLESAFGRNQYPDIWAREGLAQ 101

  Fly   103 KINLPESRVQVWFKNRRAKCRQQLQQQQQSNSLSSSKNASG 143
            ...|.|:|:||||:|||||.|:|.:...|..:..|:...||
Mouse   102 DTGLSEARIQVWFQNRRAKQRKQERSLLQPIAHLSTATFSG 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeodomain 68..123 CDD:459649 32/54 (59%)
Prop1NP_032962.1 Homeodomain 67..123 CDD:459649 32/55 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 168..223
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 7/31 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.