DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and Otx2

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001273410.1 Gene:Otx2 / 18424 MGIID:97451 Length:297 Species:Mus musculus


Alignment Length:322 Identity:115/322 - (35%)
Similarity:145/322 - (45%) Gaps:80/322 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PP----GMPMPSLGPFGLPHGLEAVGFSQGMW----GVNTRKQRRERTTFTRAQLDVLEALFGKT 89
            ||    |:.:.:.| ..|.|  .:||: .|.|    ....||||||||||||||||||||||.||
Mouse     8 PPYAVNGLSLTTSG-MDLLH--PSVGY-PGPWASCPAATPRKQRRERTTFTRAQLDVLEALFAKT 68

  Fly    90 RYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQQQSNSLSSSKNASGGGSGNSCSSSS 154
            ||||||||||||||||||||||||||||||||||||.||||                        
Mouse    69 RYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQ------------------------ 109

  Fly   155 ANSRSNSNNNGSSSNNNTQSSGGNNSNKSSQKQGN--SQSSQQGGGSSGGNNSNNNSAAAAASAA 217
                                :||.|..:.::|:.:  .:.|.:.|.|...:..::.|....||::
Mouse   110 --------------------NGGQNKVRPAKKKSSPAREVSSESGTSGQFSPPSSTSVPTIASSS 154

  Fly   218 AAVAAAQSIKTHHSSFLSAAAAAASGGTNQSANNNSNNNNQGNSTPNSSSSGGGGGSQAGGHLSA 282
            |.|    ||.:..|....:...:.|....|.:...:.....|.|...:.|:...||...|.:|  
Mouse   155 APV----SIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYL-- 213

  Fly   283 AAAAAALNVTAAHQNSSPLLPTPATSVSPVSIVCKKEHLSGGYGSSVGGGGGGGGASSGGLN 344
                     |..|..    ||.|..::||:.......||:   .|.......|.||||.|.|
Mouse   214 ---------TPMHHQ----LPGPGATLSPMGTNAVTSHLN---QSPASLSTQGYGASSLGFN 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 50/51 (98%)
Otx2NP_001273410.1 Homeobox 50..102 CDD:365835 50/51 (98%)
TF_Otx 161..242 CDD:367546 19/98 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5988
eggNOG 1 0.900 - - E1_KOG2251
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm43101
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3028
SonicParanoid 1 1.000 - - X850
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.