DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and Sebox

DIOPT Version :10

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_032785.1 Gene:Sebox / 18292 MGIID:108012 Length:190 Species:Mus musculus


Alignment Length:158 Identity:49/158 - (31%)
Similarity:70/158 - (44%) Gaps:44/158 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAK---------CR 123
            ||:||||:..||..||.:|....||||..||.:|...:|||:::||||:|||||         ..
Mouse    19 RRKRTTFSVGQLVELERVFAARPYPDISTREHLAQVTHLPEAKIQVWFQNRRAKRIKDRKPGALN 83

  Fly   124 QQLQQQQQSNSL--------------------SSSKNASGGGSGNSC---------SSSSANSRS 159
            .:|:....|.||                    ||::..|......||         |.|.|...:
Mouse    84 SRLELPPNSCSLPDTPQLPWDPGTSSHPLHPTSSAQYTSACPPQTSCLGPILGPGQSWSGAKVAA 148

  Fly   160 NSNNNGSSSNNNT------QSSGGNNSN 181
            ....:|:|..:::      |:|.||.|:
Mouse   149 PWGTSGASGIHSSLEQIVPQTSLGNLSD 176

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeodomain 68..123 CDD:459649 30/63 (48%)