DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and Nobox

DIOPT Version :10

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_570939.1 Gene:Nobox / 18291 MGIID:108011 Length:527 Species:Mus musculus


Alignment Length:152 Identity:41/152 - (26%)
Similarity:65/152 - (42%) Gaps:31/152 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GPHPHHSVPHGPLPPGMPMPSLGPFGLPHGLEAVGFSQGMWGVNTRK--------------QRRE 70
            ||   .|...|..||.....||.|     .:.||........:|:.:              :::.
Mouse    83 GP---QSEEEGCSPPERKAESLKP-----SISAVPGQATAGSLNSHEGDLKKESLEVTCQFRKKT 139

  Fly    71 RTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR--QQLQQQQQSN 133
            ||.:...||:.||.:|.:..|||...|.|::..:.:...|:.|||:|||||.|  ::|.:::   
Mouse   140 RTLYRSDQLEELERIFQEDHYPDSDKRHEISQMVGVTPQRIMVWFQNRRAKWRKVEKLNEKE--- 201

  Fly   134 SLSSSKNASGGGSGNSCSSSSA 155
                :||.....|.:|....||
Mouse   202 ----TKNGPAAPSADSSQHRSA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeodomain 68..123 CDD:459649 21/54 (39%)
NoboxNP_570939.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..126 12/50 (24%)
COG5576 94..213 CDD:227863 33/130 (25%)
Homeodomain 137..193 CDD:459649 21/55 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..245 7/33 (21%)
PHA03247 <206..454 CDD:223021 4/14 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..306
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 488..527
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.