DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and ceh-37

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001360629.1 Gene:ceh-37 / 181530 WormBaseID:WBGene00000458 Length:292 Species:Caenorhabditis elegans


Alignment Length:230 Identity:72/230 - (31%)
Similarity:108/230 - (46%) Gaps:48/230 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PGMPMPSLGPFGLPHGLEAVGFSQGMWGVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMRE 98
            |..||....  |.|:....:          .||.||||||::|.||::||.||.:|:|||:|.||
 Worm    34 PVQPMTMFS--GAPYNAAMI----------PRKNRRERTTYSRQQLEILETLFNETQYPDVFARE 86

  Fly    99 EVALKINLPESRVQVWFKNRRAKCR-QQLQQQQQSNSLSSSKNA--------------SGGGSG- 147
            .||.:|.|.|||:||||||||||.| |:.|:.::||..|....:              .||..| 
 Worm    87 RVADQIRLQESRIQVWFKNRRAKYRLQEKQKPKRSNEKSQEHKSEDQQQTDVLDGEPLKGGSPGY 151

  Fly   148 --------NSCSSSSANSRSNSNNNGSSSNNNTQSSGGNNSNKSSQKQGNSQSSQQGGGSSGGNN 204
                    .||..:.|:.:..:..:.|.......::..|.|  :::.|.|......|.|.   |.
 Worm   152 QPQIKSELESCDGAVASGKLGTPKSISPVETTASTTSSNTS--AAELQWNGDHKILGFGK---NE 211

  Fly   205 SNNNSA-------AAAASAAAAVAAAQSIKTHHSS 232
            :..::|       |:..|:::::.|..|:.|..||
 Worm   212 TTTSAAVSPTADNASTPSSSSSITATSSLPTTSSS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 34/51 (67%)
ceh-37NP_001360629.1 Homeobox 59..111 CDD:365835 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2251
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X850
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.770

Return to query results.
Submit another query.